Pasang Iklan Baris Gratis Tanpa Daftar

Kategori: Internet - Web Hosting

Sabuk Bayu Aji Bertuah

31 Agustus 2020 15:06 | Dibaca 301 kali

insya Allah berdaya tuah sangat ampuh, karena didalamnya terkandung sirri dari rajah/wifik, pengisian berbagai ilmu khikmah, asma, ajian dll. sehingga bagi siapa saja yang memakai sabuk tersebut akan memancarkan daya aura pengasian yang sangat kuat, kharisma dan wibawa tinggi, sehingga siapapun yang melihat akan terpesona, disenangi kawan maupun lawan, banyak…

Dikirim Oleh : UST.ALI MASHUDI,GMH Kontak: 082327381911 Link: Kunjungi Website
Alamat: Jawa Tengah Tags: Jasa, sabuk bayu aji, sabuk bertuah, sabuk karomah
Iklan Premium

Ruwatan Tempat Tinggal/usaha Menghilangkan Segala Energi Negatif

31 Agustus 2020 15:24 | Dibaca 141 kali

Ruwatan Tempat Tinggal / Usaha Merupakan Media Khusus Untuk Menghilangkan Berbagai Energi Negatif / Ghoib Negatif Yang Bersarang Dalam Tempat Tinggal / Usaha Anda. Energi Negatif / Ghoib Negatif Yang Menyelimuti Tempat Tinggal / Usaha Anda Bisa Menyebabkan Berbagai Musibah, Kesialan, Rasa Tidak Nyaman, Banyak Permasalahan Yang Datang Atau Membuat…

Dikirim Oleh : UST.ALI MASHUDI,GMH Kontak: 082327381911 Link: Kunjungi Website
Alamat: Jawa Tengah Tags: Jasa, ruwatan tempat tinggal, ruwatan tempat usaha, pembersih energi negatif, mengusir jin, manghalau sihir, buang sial
Iklan Premium

Minyak Babur Rizky (Media Penglarisan + Kerezekian)

31 Agustus 2020 15:46 | Dibaca 167 kali

Minyak Babur Rizky? Mungkin Anda Mulai Bertanya-Tanya Dengan Minyak Ini, Apakah Sebenarnya Minyak Ini? Apakah Kegunaanya? Apakah Fungsi Dan Kelebihan Yang Dimiliki Oleh Minyak Babur Rizky Ini? Minyak Babur Rizky Adalah Sebuah Minyak Yang Secara Kandungannya Yang Dipercaya Dan Diyakini Berhubungan Dengan Datangnya Rejeki. Biasanya Minyak Ini Diletakkan Di Rumah…

Dikirim Oleh : UST.ALI MASHUDI,GMH Kontak: 082327381911 Link: Kunjungi Website
Alamat: Jawa Tengah Tags: Jasa, minyak babur rizky, minyak karomah, minyak penglarisan, minyak kerezekian
Iklan Premium

Pijat Panggilan Bali 24 Jam Terapis Pria dan Wanita

24 Desember 2020 11:01 | Dibaca 56 kali

Pijat Panggilan Bali 24 Jam Bali Merupakan daerah pariwisata berkelas dunia yang ada di indonesia dan dikenal sebagai Pulau Dewata. Ada banyak Tempat Pijat, Spa dan reflexology mulai dari Berlabel Spa mewah hingga yang biasa biasa Pijat panggilan Bali 24 jam terapis pria dan wanita Semakin banyaknya permintaan menggunakan jasa…

Dikirim Oleh : sekar Kontak: 081252423168 Link: Kunjungi Website
Alamat: denpasar Tags: Jasa, pijat bali, pijat panggilan bali, spa bali, reflexology, terapi kesehatan
Iklan Premium

Central Park Office Tower

05 Januari 2021 12:57 | Dibaca 48 kali

Lokasi di Kawasan Terpadu Podomoro City : Central Park Mall/Apartment, Pullman Hotel, Royal Garden Residence, Mediterania Garden Residence1, Mediterania Garden Residence2. Sebelah Mall Taman Anggrek, Gramedia, Carrefour, Dekat: SMAK1 Penabur, Ukrida, Untar, Mall Ciputra, Terminal Grogol/Busway, Usakti, Jakarta Barat Luas : 143 m2 Kondisi : sudah renovasi , SHM Lantai…

Dikirim Oleh : Liu Hendra Subrata Kontak: 081284776879 Link: Kunjungi Website
Alamat: DKI Jakarta Tags: Kantor, jual kantor strategis, sewa ruang kantor
Iklan Premium

Massage Panggilan Online Jakarta

10 Januari 2021 16:44 | Dibaca 58 kali

Massage Panggilan Jakarta Traditional Massage & Body Glow khusus Hotel & Apartemen Terapis Kami Berpengalaman Melayani Dengan Hati dan dengan biaya Terjangkau tentunya, Jasa Kami Khusus Hotel & Apartement Saja. Apa itu Traditional Massage? Traditional Massage Adalah Pijat dari telapak kaki dan badan, finishing di urut memakai krim untuk…

Dikirim Oleh : Kontak: 08881588212 Link: Kunjungi Website
Alamat: Jakarta Tags: Jasa, traditional massage, massage jakarta, massage panggilan online jakarta, massage body glow
Iklan Premium


18 Januari 2021 09:03 | Dibaca 12 kali

Kapolri Jenderal (Pol) Idham Azis menjadi anggota kepolisian pertama yang akan menerima suntikan vaksin Covid-19 perdana

Pengiklan: IDLOOS, Alamat: SURABAYA, Kontak: -
Link: Link Website Tags: Web Hosting, kapolrimenjadidaftarpertamapenerimavaksindikorpbhayangkara

Apa Itu Hosting? Berikut Penjelasannya

31 Agustus 2020 14:01 | Dibaca 66 kali

Kamu pengen membuat website? Sebelum membuat website, kenalan dulu yuk sama hosting. Memang, apa itu hosting? Kenapa penting banget harus tahu hosting? Jadi, begini. Membuat website itu sama seperti membuat rumah. Kamu harus cari lahannya, menentukan alamatnya, dan lain-lain. Nah, kalau hosting itu lahan yang akan kamu bangun jadi website…

Pengiklan: Share Net
Link: Link Website Tags: Web Hosting,

Ini Pengertian Domain dan Hosting serta berbagai macam jenisnya

31 Agustus 2020 12:17 | Dibaca 53 kali

Saat Anda berselancar di internet, Anda mungkin sering mendengar kata domain dan hosting. Apalagi jika Anda baru membuat website, mungkin Anda akan bingung tentang perbedaan domain dan hosting. Pada artikel kali ini,kami akan membahas beberapa hal tentang domain dan hosting yang dapat Anda pelajari. Definisi Domain Domain diibaratkan sebagai alamat.…

Pengiklan: Web Net
Link: Link Website Tags: Web Hosting,

Manfaat Menggunakan Litespeed Web Server

31 Agustus 2020 12:10 | Dibaca 56 kali

Pada kesempatan kali ini Kami akan membuat artikel tentang pengenalan apa itu litespeed, di karenakan Litespeed adalah sebuah terobosan baru dari teknologi web server yang merupakan pengganti Apache Web Server.Silahkan bisa di pelajari atau simak Mengenal Lebih Dekat Litespeed Apa itu Litespeed Web Server? Litespeed Web Server adalah teknologi Web…

Pengiklan: Web Net
Link: Link Website Tags: Web Hosting,